PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AMDW01037211.1_FGP001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 139aa    MW: 15120 Da    PI: 5.6523
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AMDW01037211.1_FGP001genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS137.21.8e-421132241374
                   GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvp 328
                            +veq+++h s+sFl+rf+ea++yysalfdsl+a+++++s er++vE++ll+rei+nv+a  g +r+ + + +++Wre+l ++GF+  +
  AMDW01037211.1_FGP001   1 MVEQDLSH-SGSFLARFVEAIHYYSALFDSLDASYSEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVK-FGSWREKLAQSGFRVSS 86 
                            699****9.899****************************************************999987.***************** PP

                   GRAS 329 lsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                            l  +aa+qa lll +++sdgy++ ee+g+l lgWkd  L+++SaWr
  AMDW01037211.1_FGP001  87 LAGSAAAQAALLLGMFPSDGYTLIEENGALKLGWKDLCLLTASAWR 132
                            *********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035146.2E-401132IPR005202Transcription factor GRAS
PROSITE profilePS5098519.8561112IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MVEQDLSHSG SFLARFVEAI HYYSALFDSL DASYSEDSPE RHVVEQQLLS REIRNVLAVG  60
GPARTGDVKF GSWREKLAQS GFRVSSLAGS AAAQAALLLG MFPSDGYTLI EENGALKLGW  120
KDLCLLTASA WRPIQASGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-143132243375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620600.12e-93PREDICTED: protein SCARECROW 2
SwissprotA2ZAX52e-95SCR1_ORYSI; Protein SCARECROW 1
TrEMBLA0A0E0IXM31e-96A0A0E0IXM3_ORYNI; Uncharacterized protein
STRINGBGIOSGA034703-PA2e-93(Oryza sativa Indica Group)
STRINGBGIOSGA036912-PA2e-93(Oryza sativa Indica Group)
STRINGLOC_Os12g02870.15e-93(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137138122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.16e-62GRAS family protein